PDB entry 6igg

View 6igg on RCSB PDB site
Description: Crystal structure of FT condition 1
Class: plant protein
Keywords: flowering control, PLANT PROTEIN
Deposited on 2018-09-25, released 2019-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein FLOWERING LOCUS T
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SXZ2 (3-End)
      • expression tag (0-2)
      • engineered mutation (109)
      • engineered mutation (166)
    Domains in SCOPe 2.08: d6igga1, d6igga2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6iggA (A:)
ishmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtngldlrpsqvqnkprveig
gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres

    Sequence, based on observed residues (ATOM records): (download) 
    >6iggA (A:)
ishmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtngldlrpsqvqnkprveig
gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre