PDB entry 6igf

View 6igf on RCSB PDB site
Description: Crystal structure of Human Papillomavirus type 52 pentamer
Class: structural protein
Keywords: Human Papillomavirus type 52 capsid protein, STRUCTURAL PROTEIN
Deposited on 2018-09-25, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfa_
  • Chain 'B':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfb_
  • Chain 'C':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfc_
  • Chain 'D':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfd_
  • Chain 'E':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfe_
  • Chain 'F':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igff_
  • Chain 'G':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfg_
  • Chain 'H':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfh_
  • Chain 'I':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfi_
  • Chain 'J':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 52 [TaxId:10618]
    Gene: L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6igfj_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6igfA (A:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfA (A:)
    kvvstdeyvsrtsiyyyagssrlltvghpyfsiknkkvlvpkvsglqyrvfriklpdpnk
    fgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgid
    nreclsmdykqtqlcilgckppigehwgkgtpcnpgdcpplqlinsviqdgdmvdtgfgc
    mdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtl
    gdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicw
    gnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltad
    vmtyihkmdatiledwqfedplkdymfwevdlkekfsadldqfplgrkfllqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6igfB (B:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfB (B:)
    pvpvskvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfri
    klpdpnkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnky
    agkpgidnreclsmdykqtqlcilgckppigehwgkgtpnpgdcpplqlinsviqdgdmv
    dtgfgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhff
    nragtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlck
    itltadvmtyihkmdatiledwqfedplkdymfwevdlkekfsadldqfplgrkfllqag
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6igfC (C:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfC (C:)
    skvvstdeyvsrtsiyyyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfri
    klpdpnkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnky
    agkpgidnreclsmdykqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsvi
    qdgdmvdtgfgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqm
    fvrhffnragtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywl
    qraqghnngicwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqf
    ifqlckitltadvmtyihkmdatiledwqfedplkdymfwevdlkekfsadldqfplgrk
    fllqagl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6igfD (D:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfD (D:)
    kvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfriklpdp
    nkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpg
    idnreclsmdykqtqlcilgckppigehwgkgtpcgnpgdcpplqlinsviqdgdmvdtg
    fgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnra
    gtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnng
    icwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitl
    tadvmtyihkmdatiledwqfdplkdymfwevdlkekfsadldqfplgrkfllq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6igfE (E:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfE (E:)
    pvpvskvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfri
    klpdpnkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnky
    agkpgidnreclsmdykqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsvi
    qdgdmvdtgfgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqm
    fvrhffnragtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywl
    qraqghnngicwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqf
    ifqlckitltadvmtyihkmdatiledwqfdplkdymfwevdlkekfsadldqfplgrkf
    llqaglqar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6igfF (F:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfF (F:)
    kvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfriklpdp
    nkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpg
    idnreclsmdykqtqlcilgckppigehwgkgtpcnpgdcpplqlinsviqdgdmvdtgf
    gcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnrag
    tlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngi
    cwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitlt
    advmtyihkmdatiledwqfedplkdymfwevdlkekfsadldqfplgrkfllqagl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6igfG (G:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfG (G:)
    kvvstdeyvsrtsiyyyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfrik
    lpdpnkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkya
    gkpgidnreclsmdykqtqlcilgckppigehwgkgtpnpgdcpplqlinsviqdgdmvd
    tgfgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffn
    ragtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghn
    ngicwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlcki
    tltadvmtyihkmdatiledwqfedplkdymfwevdlkekfsadldqfplgrkfllqa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6igfH (H:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfH (H:)
    kvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfriklpdp
    nkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpg
    idnreclsmdykqtqlcilgckppigehwgkgtpcnpgdcpplqlinsviqdgdmvdtgf
    gcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnrag
    tlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngi
    cwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitlt
    advmtyihkmdatiledwqfedplkdymfwevdlkekfsadldqfplgrkfllqag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6igfI (I:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfI (I:)
    kvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfriklpdp
    nkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpg
    idnreclsmdykqtqlcilgckppigehwgkgtpcgnpgdcpplqlinsviqdgdmvdtg
    fgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnra
    gtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnng
    icwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitl
    tadvmtyihkmdatiledwqfdplkdymfwevdlkekfsadldqfplgrkfllqag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6igfJ (J:)
    mvqilfyilvifyyvagvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrlltvghpyfsikntssgngkkvlvpkvsglqyrvfriklpdpnkfgfpdtsfy
    npetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagkpgidnreclsmdy
    kqtqlcilgckppigehwgkgtpcnnnsgnpgdcpplqlinsviqdgdmvdtgfgcmdfn
    tlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnragtlgdpv
    pgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnngicwgnql
    fvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckitltadvmty
    ihkmdatiledwqfgltpppsasledtyrfvtstaitcqkntppkgkedplkdymfwevd
    lkekfsadldqfplgrkfllqaglqarpklkrpassaprtstkkkkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igfJ (J:)
    vskvvstdeyvsrtsiyyyagssrlltvghpyfsikntgkkvlvpkvsglqyrvfriklp
    dpnkfgfpdtsfynpetqrlvwactgleigrgqplgvgisghpllnkfddtetsnkyagk
    pgidnreclsmdykqtqlcilgckppigehwgkgtpgnpgdcpplqlinsviqdgdmvdt
    gfgcmdfntlqasksdvpidicssvckypdylqmasepygdslffflrreqmfvrhffnr
    agtlgdpvpgdlyiqgsnsgntatvqssaffptpsgsmvtsesqlfnkpywlqraqghnn
    gicwgnqlfvtvvdttrstnmtlcaevkkestyknenfkeylrhgeefdlqfifqlckit
    ltadvmtyihkmdatiledwqfdplkdymfwevdlkekfsadldqfplgrkfllqag