PDB entry 6igd

View 6igd on RCSB PDB site
Description: Crystal structure of HPV58/33 chimeric L1 pentamer
Class: structural protein
Keywords: capsid protein, STRUCTURAL PROTEIN
Deposited on 2018-09-25, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igda_
  • Chain 'B':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdb_
  • Chain 'C':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdc_
  • Chain 'D':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdd_
  • Chain 'E':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igde_
  • Chain 'F':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdf_
  • Chain 'G':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdg_
  • Chain 'H':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdh_
  • Chain 'I':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdi_
  • Chain 'J':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 58 [TaxId:10598]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26535
      • engineered mutation (79)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (86)
      • engineered mutation (201)
      • engineered mutation (377)
    Domains in SCOPe 2.07: d6igdj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6igdA (A:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdA (A:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvasatdcpplelfnsiiedgdmvdtg
    fgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnra
    gklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngic
    wgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitlta
    eimtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6igdB (B:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdB (B:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvatdcpplelfnsiiedgdmvdtgfg
    cmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragk
    lgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwg
    nqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaei
    mtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6igdC (C:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdC (C:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvastdcpplelfnsiiedgdmvdtgf
    gcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnrag
    klgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicw
    gnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltae
    imtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6igdD (D:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdD (D:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvaatdcpplelfnsiiedgdmvdtgf
    gcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnrag
    klgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicw
    gnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltae
    imtyihtmdsniledwqfkedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6igdE (E:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdE (E:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgd
    mvdtgfgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrh
    ffnragklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlck
    itltaeimtyihtmdsniledwqfdplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6igdF (F:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdF (F:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvasatdcpplelfnsiiedgdmvdtg
    fgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnra
    gklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngic
    wgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitlta
    eimtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6igdG (G:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdG (G:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvatdcpplelfnsiiedgdmvdtgfg
    cmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragk
    lgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwg
    nqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaei
    mtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6igdH (H:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdH (H:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvastdcpplelfnsiiedgdmvdtgf
    gcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnrag
    klgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicw
    gnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltae
    imtyihtmdsniledwqfdplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6igdI (I:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdI (I:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvasatdcpplelfnsiiedgdmvdtg
    fgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnra
    gklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngic
    wgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitlta
    eimtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsgl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6igdJ (J:)
    mvlilcctlailfcvadvnvfhiflqmsvwrpseatvylppvpvskvvstdeyvsrtsiy
    yyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlpdpnkfgfpdtsfynp
    dtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaqpgsdnreclsmdykq
    tqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgdmvdtgfgcmdfgtlq
    anksdvpidicnstckypdylkmasepygdslffflrreqmfvrhffnragklgeavpdd
    lyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqghnngicwgnqlfvtvv
    dttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlckitltaeimtyihtmd
    sniledwqfgltpppsaslqdtyrfvtsqaitcqktappkekedplnkytfwevnlkekf
    sadldqfplgrkfllqsglkakprlkrsapttrapstkrkkvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6igdJ (J:)
    kvvstdeyvsrtsiyyyagssrllavgnpyfsiknptnakkllvpkvsglqyrvfrvrlp
    dpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgvsghpylnkfddtetsnrypaq
    pgsdnreclsmdykqtqlcligckpptgehwgkgvasnnnaaatdcpplelfnsiiedgd
    mvdtgfgcmdfgtlqanksdvpidicnstckypdylkmasepygdslffflrreqmfvrh
    ffnragklgeavpddlyikgsgntaviqssaffptpsgsivtsesqlfnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmtlctevtkestykndnfkeyvrhveeydlqfvfqlck
    itltaeimtyihtmdsniledwqfedplnkytfwevnlkekfsadldqfplgrkfllqsg
    l