PDB entry 6ig7

View 6ig7 on RCSB PDB site
Description: Crystal structure of thermolysin delivered in polyacrylamide using x-ray free electron laser
Class: hydrolase
Keywords: thermolysin, xfel, serial femtosecond crystallography, sfx, x-ray free electron laser, HYDROLASE
Deposited on 2018-09-25, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Gene: npr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ig7a_
  • Chain 'B':
    Compound: leu-lys
    Species: Bacillus thermoproteolyticus [TaxId:1427]
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ig7A (A:)
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

  • Chain 'B':
    No sequence available.