PDB entry 6ift

View 6ift on RCSB PDB site
Description: KsgA from Bacillus subtilis in complex with SAM
Class: transferase
Keywords: KsgA, SAM, methyltransferase, resistance, TRANSFERASE
Deposited on 2018-09-21, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal RNA small subunit methyltransferase A
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: rsmA, ksgA, BSU00420
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ifta_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6iftA (A:)
mnkdiatpirtkeilkkygfsfkkslgqnflidtnilnrivdhaevtektgvieigpgig
alteqlakrakkvvafeidqrllpilkdtlspyenvtvihqdvlkadvksvieeqfqdcd
eimvvanlpyyvttpiimklleehlplkgivvmlqkevaermaadpsskeygslsiavqf
yteaktvmivpktvfvpqpnvdsavirlilrdgpavdvenesfffqlikasfaqrrktll
nnlvnnlpegkaqkstieqvleetnidgkrrgeslsieefaalsnglykalf