PDB entry 6ifr

View 6ifr on RCSB PDB site
Description: type iii-a csm complex, cryo-em structure of csm-ntr, atp bound
Deposited on 2018-09-21, released 2018-12-12
The last revision was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: EM
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type III-A CRISPR-associated protein Csm1
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2U2M0F3 (Start-757)
      • engineered mutation (15)
  • Chain 'B':
    Compound: Type III-A CRISPR-associated RAMP protein Csm4
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: csm4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Type III-A CRISPR-associated protein Csm2
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: CSM2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Type III-A CRISPR-associated protein Csm2
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: CSM2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Type III-A CRISPR-associated RAMP protein Csm3
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: csm3
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Type III-A CRISPR-associated RAMP protein Csm3
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: csm3
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2U2M035 (0-End)
      • engineered mutation (32)
  • Chain 'G':
    Compound: Type III-A CRISPR-associated RAMP protein Csm3
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: csm3
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Type III-A CRISPR-associated RAMP protein Csm5
    Species: Streptococcus thermophilus ND03 [TaxId:767463]
    Gene: csm5
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: type III-A CRISPR-Cas interference complex, NTR
    Species: Streptococcus thermophilus ND03, synthetic [TaxId:767463]
  • Chain 'N':
    Compound: type III-A CRISPR-Cas interference complex, crRNA
    Species: Streptococcus thermophilus ND03, synthetic [TaxId:767463]
  • Heterogens: ATP, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ifrA (A:)
    mkkekidlfygallhnigkviqratgerkkhalvgadwfdeiadnqvisdqiryhmanyq
    sdklgndhlayityiadniasgvdrrqsneesdedtsakiwdtytnqadifnvfgaqtdk
    ryfkptvlnlkskpnfasatyepfskgdyaaiatriknelaefefnqvqidsllnlfeat
    lsfvpsstntkeiadisladhsrltaafalaiydyledkgrhnykedlftkvsafyeeea
    fllasfdlsgiqdfiyniniatngaakqlkarslyldfmseyiadslldklglnranmly
    vggghayfvlantektvetlvqfekdfnqfllanfqtrlyvafgwgsfaakdimselnsp
    esyrqvyqkasrmiskkkisrydyqtlmllnrggkssereceichsvenlvsyhdqkvcd
    icrglyqfskeiahdhfiiteneglpigpnaclkgvafeklsqeafsrvyvkndykagtv
    kathvfvgdyqcdeiynyaalsknenglgikrlavvrldvddlgaafmagfsqqgngqys
    tlsrsatfsrsmslffkvyinqfasdkklsiiyaggddvfaigswqdiiaftvelrenfi
    kwtngkltlsagiglfadktpislmahqtgeleeaakgnekdsislfssdytfkfdrfit
    nvyddkleqiryffnhqdergknfiykliellrnhdrmnmarlayyltrleeltretdrd
    kfktfknlfyswytnkndkdrkeaelalllyiyeirkd
    

    Sequence, based on observed residues (ATOM records):
    >6ifrA (A:)
    kkekidlfygallhnigkviqratgerkkhalvgadwfdeiadnqvisdqiryhmadhla
    yityiadniasgytnqadifnvfgaqtdkryfkptvlnlkskpnfasatyepfskgdyaa
    iatriknelaefefnqvqidsllnlfeatlsfvpsstntkeiadisladhsrltaafala
    iydyledkgrhnykedlftkvsafyeeeafllasfdlsgiqdfiyniaakqlkarslyld
    fmseyiadslldklglnranmlyvggghayfvlantektvetlvqfekdfnqfllanfqt
    rlyvafgwgsfaakdimselnspesyrqvyqkasrmiskkkisrydyqtlmllnrdicrg
    lyqfskeiahdhfiiteneglpigpnaclkgvafeklsqeafsrvyvkndykagtvkath
    vfvgdyqcdeiynyaalsknenglgikrlavvrldvddlgaafmagfsqqgngqystlsr
    satfsrsmslffkvyinqfasdkklsiiyaggddvfaigswqdiiaftvelrenfikwtn
    gkltlsagiglfadktpislmahqtgeleeaakgnekdsislfssdytfkfdrfitnvyd
    dkleqiryffnhqdergknfiykliellrnhdrmnmarlayyltrleeltretdrdkfkt
    fknlfyswytnkndkdrkeaelalllyiyeirkd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ifrB (B:)
    mtyklyimtfqnahfgsgtldsskltfsadrifsalvlealkmgkldaflaeanqdkftl
    tdafpfqfgpflpkpigypkhdqidqsvdvkevrrqaklskklqflalenvddylngelf
    eneehavidtvtknqphkddnlyqvattrfsndtslyvianesdllnelmsslqysglgg
    krssgfgrfeldiqniplelsdrltknhsdkvmslttalpvdadleeamedghylltkss
    gfafshatnenyrkqdlykfasgstfsktfegqivdvrpldfphavlnyakplffklev
    

    Sequence, based on observed residues (ATOM records):
    >6ifrB (B:)
    tyklyimtfqnahfgsgtldsskltfsadrifsalvlealkmgkldaflaeanqdkftlt
    dafpfqfgpflpkpigypkdvkevrrqaklskklqflalenvddylngelfeneehavid
    tvtknqphkddnlyqvattrfsndtslyvianesdllnelmsslqysglggkrssgfgrf
    eldiqniplelsdrltknhsdkvmslttalpvdadleeamedghylltkssgfafshatn
    enyrkqdlykfasgstfsktfegqivdvrpldfphavlnyakplffkl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ifrC (C:)
    mtiltdenyvdiaekailklerntrnrknpdafflttsklrnllsltstlfdeskvkeyd
    alldriaylrvqfvyqagreiavkdliekaqilealkeikdretlqrfcrymealvayfk
    fyggkd
    

    Sequence, based on observed residues (ATOM records):
    >6ifrC (C:)
    iltdenyvdiaekailklerntrnrknpdafflttsklrnllsltstlfdeskvkeydal
    ldriaylrvqfvyqagreiavkdliekaqilealkeikdretlqrfcrymealvayfkfy
    g
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6ifrD (D:)
    mtiltdenyvdiaekailklerntrnrknpdafflttsklrnllsltstlfdeskvkeyd
    alldriaylrvqfvyqagreiavkdliekaqilealkeikdretlqrfcrymealvayfk
    fyggkd
    

    Sequence, based on observed residues (ATOM records):
    >6ifrD (D:)
    iltdenyvdiaekailklerntrnrknpdafflttsklrnllsltstlfdeskvkeydal
    ldriaylrvqfvyqagreiavkdliekaqilealkeikdretlqrfcrymealvayfkfy
    g
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6ifrE (E:)
    mtfakikfsaqirletglhiggsdafaaigainspvikdpitnlpiipgsslkgkmrtll
    akvynekvaekpsddsdilsrlfgnskdkrfkmgrlifrdaflsnadeldslgvrsytev
    kfentidritaeanprqierairnstfdfeliyeitdenenqveedfkvirdglklleld
    ylggsgsrgygkvafenlkattvfgnydvktlnelltaev
    

    Sequence, based on observed residues (ATOM records):
    >6ifrE (E:)
    tfakikfsaqirletglhiggsdafaaigainspvikdpitnlpiipgsslkgkmrtlla
    kvyndilsrlfgnskdkrfkmgrlifrdaflsnadeldslgvrsytevkfentidritae
    anprqierairnstfdfeliyeitdenenqveedfkvirdglklleldylggsgsrgygk
    vafenlkattvfgnydvktlnellt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6ifrF (F:)
    mtfakikfsaqirletglhiggsdafaaigainspvikdpitnlpiipgsslkgkmrtll
    akvynekvaekpsddsdilsrlfgnskdkrfkmgrlifrdaflsnadeldslgvrsytev
    kfentidritaeanprqierairnstfdfeliyeitdenenqveedfkvirdglklleld
    ylggsgsrgygkvafenlkattvfgnydvktlnelltaev
    

    Sequence, based on observed residues (ATOM records):
    >6ifrF (F:)
    mtfakikfsaqirletglhiggsdafaaigainspvikdpitnlpiipgsslkgkmrtll
    akvynekvaekpsddsdilsrlfgnskdkrfkmgrlifrdaflsnadeldslgvrsytev
    kfentidritaeanprqierairnstfdfeliyeitdenenqveedfkvirdglklleld
    ylggsgsrgygkvafenlkattvfgnydvktlnellt
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6ifrG (G:)
    mtfakikfsaqirletglhiggsdafaaigainspvikdpitnlpiipgsslkgkmrtll
    akvynekvaekpsddsdilsrlfgnskdkrfkmgrlifrdaflsnadeldslgvrsytev
    kfentidritaeanprqierairnstfdfeliyeitdenenqveedfkvirdglklleld
    ylggsgsrgygkvafenlkattvfgnydvktlnelltaev
    

    Sequence, based on observed residues (ATOM records):
    >6ifrG (G:)
    tfakikfsaqirletglhiggsdafaaigainspvikdpitnlpiipgsslkgkmrtlla
    kvynekvaekpsddsdilsrlfgnskdkrfkmgrlifrdaflsnadeldslgvrsytevk
    fentidritaeanprqierairnstfdfeliyeitdenenqveedfkvirdglklleldy
    lggsgsrgygkvafenlkattvfgnydvktlnellta
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6ifrH (H:)
    mkndyrtfklslltlapihigngekytsrefiyenkkfyfpdmgkfynkmvekrlaekfe
    afliqtrpnarnnrlisflndnriaersfggysisetglesdknpnsagainevnkfird
    afgnpyipgsslkgairtilmnttpkwnnenavndfgrfpkenknlipwgpkkgkeyddl
    fnairvsdskpfdnkslilvqkwdysaktnkakplplyresispltkiefeittttdeag
    rlieelgkraqafykdykafflsefpddkiqanlqypiylgagsgawtktlfkqadgilq
    rrysrmktkmvkkgvlkltkaplktvkipsgnhslvknhesfyemgkanfmikeidk
    

    Sequence, based on observed residues (ATOM records):
    >6ifrH (H:)
    ndyrtfklslltlapihigngekytsrefiyenkkfyfpdmgkfynkmvekrlaekfeaf
    liqtrpnarnnrlisflndnriaersfggysisetglesdknpnsagainevnkfirdaf
    gnpyipgsslkgairtilmnttpkwnnenavndfgrfpkenknlipwgpkkgkeyddlfn
    airvsdskpfdnkslilvqkwdysaktnkakplplyresispltkiefeittttdeagrl
    ieelgkraqafykdykafflsefpddkiqanlqypiylgagsgawtktlfkqadgilqrr
    ysrmktkmvkkgvlkltkaplktvkipsgnhslvknhesfyemgkanfmikei
    

  • Chain 'J':
    No sequence available.

  • Chain 'N':
    No sequence available.