PDB entry 6ifh

View 6ifh on RCSB PDB site
Description: Unphosphorylated Spo0F from Paenisporosarcina sp. TG-14
Class: transferase
Keywords: Paenisporosarcina sp. TG-14, spore formation, Spo0F, TRANSFERASE
Deposited on 2018-09-20, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sporulation initiation phosphotransferase f
  Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
  Database cross-references and differences (RAF-indexed):
  • PDB 6IFH (0-118)
  Domains in SCOPe 2.08: d6ifha_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ifhA (A:)
  mkqllivddqqgirlllnevfkregyttflaangiealdiaervkpdgvlldmkipgmdg
  ieilkriktrtpdvpvlmmtaygeldlikeamdlgashyftkpfdiyelrdavnemlrd