PDB entry 6ife

View 6ife on RCSB PDB site
Description: A Glycoside Hydrolase Family 43 beta-Xylosidase
Class: hydrolase
Keywords: Glycoside Hydrolase Family 43, beta-Xylosidase, Low-temperature Activity, Salt Tolerance, HYDROLASE
Deposited on 2018-09-20, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: B4107_1875
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K0HZF6 (18-552)
      • see sequence details (250)
      • see sequence details (505)
    Domains in SCOPe 2.07: d6ifea1, d6ifea2
  • Chain 'B':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: B4107_1875
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K0HZF6 (18-End)
      • see sequence details (250)
      • see sequence details (505)
    Domains in SCOPe 2.07: d6ifeb1, d6ifeb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ifeA (A:)
    mrgshhhhhhgmaselalmkitnpvlkgfnpdpsicrvgedyymavstfewfpgvqiyhs
    kdlvhwrlaarplqktsqldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdgh
    nylvtasevdgdwsepillnssgfdpslfhdhsgkkyvlnmlwdhrekhhsfagialqey
    svaekkligqrkvifkgtpiklteaphlyhigdyyylltaeggtryehaatiarsshieg
    pyevhpdnpivsafhvpehplqkcghasivqthtnewylahltgrpiqsskesifqqrgw
    cplgretaiqklewkdgwpyvvggkegtleveapkieekvfaptyhtvdefkestlnrhf
    qtlripftdqigsltekpqhlrlfgresltskftqafvarrwqsfyfeaetavsffpenf
    qqaaglvnyyntenwtalqvtydeelgrtlelsvcqnlafsqplthkiiipdevtyvylk
    vtvrketykysysfdqkewkeidvpfesihlsddfirgggfftgafvgmqcqdtsgerlp
    adfhyfryeetde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ifeA (A:)
    mkitnpvlkgfnpdpsicrvgedyymavstfewfpgvqiyhskdlvhwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtasevdgdwsepil
    lnssgfdpslfhdhsgkkyvlnmlwdhrekhhsfagialqeysvaekkligqrkvifkgt
    piklteaphlyhigdyyylltaeggtryehaatiarsshiegpyevhpdnpivsafhvpe
    hplqkcghasivqthtnewylahltgrpiqsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkegtleveapkieekvfaptyhtvdefkestlnrhfqtlripftdqigsltekp
    qhlrlfgresltskftqafvarrwqsfyfeaetavsffpenfqqaaglvnyyntenwtal
    qvtydeelgrtlelsvcqnlafsqplthkiiipdevtyvylkvtvrketykysysfdqke
    wkeidvpfesihlsddfirgggfftgafvgmqcqdtsgerlpadfhyfryeetde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ifeB (B:)
    mrgshhhhhhgmaselalmkitnpvlkgfnpdpsicrvgedyymavstfewfpgvqiyhs
    kdlvhwrlaarplqktsqldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdgh
    nylvtasevdgdwsepillnssgfdpslfhdhsgkkyvlnmlwdhrekhhsfagialqey
    svaekkligqrkvifkgtpiklteaphlyhigdyyylltaeggtryehaatiarsshieg
    pyevhpdnpivsafhvpehplqkcghasivqthtnewylahltgrpiqsskesifqqrgw
    cplgretaiqklewkdgwpyvvggkegtleveapkieekvfaptyhtvdefkestlnrhf
    qtlripftdqigsltekpqhlrlfgresltskftqafvarrwqsfyfeaetavsffpenf
    qqaaglvnyyntenwtalqvtydeelgrtlelsvcqnlafsqplthkiiipdevtyvylk
    vtvrketykysysfdqkewkeidvpfesihlsddfirgggfftgafvgmqcqdtsgerlp
    adfhyfryeetde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ifeB (B:)
    mkitnpvlkgfnpdpsicrvgedyymavstfewfpgvqiyhskdlvhwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtasevdgdwsepil
    lnssgfdpslfhdhsgkkyvlnmlwdhrekhhsfagialqeysvaekkligqrkvifkgt
    piklteaphlyhigdyyylltaeggtryehaatiarsshiegpyevhpdnpivsafhvpe
    hplqkcghasivqthtnewylahltgrpiqsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkegtleveapkieekvfaptyhtvdefkestlnrhfqtlripftdqigsltekp
    qhlrlfgresltskftqafvarrwqsfyfeaetavsffpenfqqaaglvnyyntenwtal
    qvtydeelgrtlelsvcqnlafsqplthkiiipdevtyvylkvtvrketykysysfdqke
    wkeidvpfesihlsddfirgggfftgafvgmqcqdtsgerlpadfhyfryeetd