PDB entry 6if7

View 6if7 on RCSB PDB site
Description: Crystal Structure of AA10 Lytic Polysaccharide Monooxygenase from Tectaria macrodonta
Class: sugar binding protein
Keywords: LPMO, chitin-binding, insecticidal, SUGAR BINDING PROTEIN
Deposited on 2018-09-18, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chitin binding protein
  Species: Tectaria macrodonta [TaxId:1137752]
  Database cross-references and differences (RAF-indexed):
  • Uniprot W5QLL4 (0-182)
    • see sequence details (70)
  Domains in SCOPe 2.08: d6if7a_
• Heterogens: CU, SO4, GOL, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6if7A (A:)
  hgsmedpisrvyrcrlenperptspacqaavalsgtqafydwnevnipnaagrhrelipd
  gqlcsagrfkyrgldlarsdwiatplpsgassfpfryiataahlgffefyvtregyqptv
  plkwadleelpfinvtnpplvsgsyqitgttpsgksgshliyviwqrtdspeafyscsdv
  yft