PDB entry 6if4

View 6if4 on RCSB PDB site
Description: crystal structure of tbtudor
Deposited on 2018-09-18, released 2019-09-18
The last revision was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone acetyltransferase
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.7.4560
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone acetyltransferase
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.7.4560
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6if4A (A:)
mvmfevrqkvyatlhetfhaaiiqevahdahtgqllyyvhyveqdsrmdrwlpgsalrer
rqglehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6if4A (A:)
vmfevrqkvyatlhetfhaaiiqevahdahtgqllyyvhyveqdsrmdrwlpgsalrerr

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6if4B (B:)
mvmfevrqkvyatlhetfhaaiiqevahdahtgqllyyvhyveqdsrmdrwlpgsalrer
rqglehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6if4B (B:)
mvmfevrqkvyatlhetfhaaiiqevahdahtgqllyyvhyveqdsrmdrwlpgsalrer
r