PDB entry 6iew

View 6iew on RCSB PDB site
Description: the crystal structure of the dnxf2 uba domain in complex with panoramix
Deposited on 2018-09-17, released 2019-08-21
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion protein of Nuclear RNA export factor 2 and Protein panoramix
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Panx, CG9754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VV73 (5-58)
      • expression tag (0-4)
      • linker (59-62)
      • linker (66)
    • Uniprot Q9W2H9 (67-93)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iewA (A:)
gplgsdvkdhklllfqevtglistwvtsiveeadwdferalklfiqknadheipdlafag
sgsgsgslskadkrslavaraelvleqiqqkank

    Sequence, based on observed residues (ATOM records):
    >6iewA (A:)
gplgsdvkdhklllfqevtglistwvtsiveeadwdferalklfiqknadheipdlafag
sgsslskadkrslavaraelvleqiqqkank