PDB entry 6ieu

View 6ieu on RCSB PDB site
Description: the structure of trim66 phd-bromo domain with unmodified h3 n terminal peptide
Deposited on 2018-09-17, released 2019-09-18
The last revision was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif-containing protein 66
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM66
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15016 (3-End)
      • expression tag (0-2)
      • engineered mutation (37)
      • engineered mutation (124)
      • engineered mutation (170)
      • engineered mutation (173)
  • Chain 'C':
    Compound: ala-arg-thr-lys-gln-thr-ala-arg-lys-ser-thr-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IEU (0-End)
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ieuA (A:)
    phmenedfcavclnggellccdrcpkvfhlschvpaltsfpggewvctlcrsltqpemey
    dsenashnqpgkraspglsmydqkkceklvlslccnnlslpfhepvsplarhyyqiikrp
    mdlstirrklqkkdpahyttpeevvsdvrlmfwncakfnypdsevaeagrslenffegwl
    keiypekrfaqprqed
    

    Sequence, based on observed residues (ATOM records):
    >6ieuA (A:)
    phmenedfcavclnggellccdrcpkvfhlschvpaltsfpggewvctlcrslspglsmy
    dqkkceklvlslccnnlslpfhepvsplarhyyqiikrpmdlstirrklqkkdpahyttp
    eevvsdvrlmfwncakfnypdsevaeagrslenffegwlkeiypekrfaq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ieuC (C:)
    artkqtarkstg
    

    Sequence, based on observed residues (ATOM records):
    >6ieuC (C:)
    artkqtarks