PDB entry 6ied

View 6ied on RCSB PDB site
Description: crystal structure of heme a synthase from bacillus subtilis
Deposited on 2018-09-13, released 2018-11-21
The last revision was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme A synthase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: ctaA, BSU14870
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12946 (6-308)
      • expression tag (0-5)
  • Heterogens: HEM, CU, SO4, OLC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6iedA (A:)
hmledpmnkalkalgvlttfvmlivliggalvtktgsgqgcgrqwplchgrffpelnpas
iiewshrfasgisiilvlslafwswrkitpifrettflaimsiiflflqallgalavvfg
snalimalhfgislisfasvliltllifeadksvrtlvkplqigkkmqfhmigiliysyi
vvytgayvrhtesslacpnvplcsplnnglptqfhewvqmghraaalllfvwiivaavha
itsykdqkqifwgwisclifitlqalsgimivyselalgfalahsffiaclfgvlcyfll
liarfryes