PDB entry 6idp

View 6idp on RCSB PDB site
Description: crystal structure of vibrio cholerae mate transporter vcmn in the straight form
Deposited on 2018-09-11, released 2019-01-16
The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MATE family efflux transporter
    Species: Vibrio cholerae [TaxId:666]
    Gene: CGT79_05080
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2A1YWE9 (Start-433)
      • expression tag (434-440)
  • Heterogens: OLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6idpA (A:)
    mamqtstsslakqlfqmtwpmlfgvlslmsfqlvdsafigqlgvlplaaqgftmpiqmvi
    igiqvglgiattavisraigagkteyakqlgglviviggigvalialvlyllrqpllgll
    gapetvfaiidhywlwwlasawtgamlyfyysvcrangntllpgtlmmvtsvlnlildpi
    fiftfdlgidgaaiatiiafgvgiaivapkvaqrqwtsyqwqdlnisqsltalghimgpa
    mlsqllpplssmfatkllasfgtaavaawalgsrfeffalvavlamtmslppmigrmlga
    keithirqlvriacqfvlgfqllialvtyvfatplaelmtsetevsqilnlhlvivpisl
    galgicmlmvsvanalgksyvaltisalrlfafylpclwlgahfygieglfigalvgnii
    agwaawlayqkalrsenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >6idpA (A:)
    qtstsslakqlfqmtwpmlfgvlslmsfqlvdsafigqlgvlplaaqgftmpiqmviigi
    qvglgiattavisraigagkteyakqlgglviviggigvalialvlyllrqpllgllgap
    etvfaiidhywlwwlasawtgamlyfyysvcrangntllpgtlmmvtsvlnlildpifif
    tfdlgidgaaiatiiafgvgiaivapkvaqrqwtsyqwqdlnisqsltalghimgpamls
    qllpplssmfatkllasfgtaavaawalgsrfeffalvavlamtmslppmigrmlgakei
    thirqlvriacqfvlgfqllialvtyvfatplaelmtsetevsqilnlhlvivpislgal
    gicmlmvsvanalgksyvaltisalrlfafylpclwlgahfygieglfigalvgniiagw
    aawlayqkalrsenlyfq