PDB entry 6ido

View 6ido on RCSB PDB site
Description: crystal structure of klebsiella pneumoniae sigma4 of sigmas fusing with the rna polymerase beta-flap-tip-helix in complex with -35 element dna
Deposited on 2018-09-10, released 2019-09-11
The last revision was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 3.75 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA polymerase sigma factor RpoS,RNA polymerase beta-flap-tip-helix
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: rpoS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9F8R5 (15-End)
    • engineered mutation (78)
  • PDB 6IDO
• Chain 'B':
  Compound: RNA polymerase sigma factor RpoS,RNA polymerase beta-flap-tip-helix
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: rpoS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9F8R5
    • engineered mutation (78)
  • PDB 6IDO
• Chain 'C':
  Compound: DNA (5'-d(p*gp*ap*tp*tp*tp*gp*tp*cp*ap*ap*gp*tp*gp*gp*c)-3')
  Species: Klebsiella pneumoniae, synthetic [TaxId:573]
  
• Chain 'D':
  Compound: DNA (5'-d(p*cp*cp*ap*cp*tp*tp*gp*ap*cp*ap*ap*ap*tp*cp*g)-3')
  Species: Klebsiella pneumoniae, synthetic [TaxId:573]
  
• Chain 'E':
  Compound: DNA (5'-d(p*gp*ap*tp*tp*tp*gp*tp*cp*ap*ap*gp*tp*gp*gp*c)-3')
  Species: Klebsiella pneumoniae, synthetic [TaxId:573]
  
• Chain 'F':
  Compound: DNA (5'-d(p*cp*cp*ap*cp*tp*tp*gp*ap*cp*ap*ap*ap*tp*cp*g)-3')
  Species: Klebsiella pneumoniae, synthetic [TaxId:573]
  

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence, based on SEQRES records:
  

  >6idoA (A:)
  gamggpedttqdddmkqsivkwlfelnakqrevlarrfgllgyeaatledvgreigltre
  rvrqiqveglrrlreilqgqglniealfregsgskgetqltpeekllraifgeka
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6idoA (A:)
  kqsivkwlfelnakqrevlarrfgllgyeaatledvgreigltrervrqiqveglrrlre
  ilqgqglniealtqltpeekllraif
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6idoB (B:)
  gamggpedttqdddmkqsivkwlfelnakqrevlarrfgllgyeaatledvgreigltre
  rvrqiqveglrrlreilqgqglniealfregsgskgetqltpeekllraifgeka
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6idoB (B:)
  qsivkwlfelnakqrevlarrfgllgyeaatledvgreigltrervrqiqveglrrlrei
  lqgtqltpeekllraif
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.