PDB entry 6idn

View 6idn on RCSB PDB site
Description: Crystal structure of ICChI chitinase from ipomoea carnea
Class: plant protein
Keywords: chitinase, glycosylation, TIM barrel, Ipomoea carnea, PLANT PROTEIN
Deposited on 2018-09-10, released 2018-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ICChI, a glycosylated chitinase
    Species: Ipomoea carnea [TaxId:89640]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IDN (0-271)
    Domains in SCOPe 2.08: d6idna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6idnA (A:)
    geiaiywgqdggegslretcdtddydiinigflttfghsttpilnltkhcnpatsackfl
    sseisyckskgikvflslgggtgnyylssrddaasvaqylwnnflggqsesrplgdesld
    gidfdiedgsndyydtlaeqlwilggrsgsnvylaaapacefpdyylreaintslfdyvw
    vqfynnprchylgnatnllnswnndwstiltddlflglpaapqaapgggfieaddlisev
    lptikatydyggvmlwskyydddysskikpdv