PDB entry 6idd

View 6idd on RCSB PDB site
Description: Crystal structure of H7 hemagglutinin mutant SH1-AVPL ( S138A, G186V, T221P, Q226L) from the influenza virus A/Shanghai/1/2013 (H7N9)
Class: viral protein
Keywords: influenza virus, H7N9, Hemagglutinin, VIRAL PROTEIN
Deposited on 2018-09-09, released 2019-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Shanghai/MH01/2013(H7N9)) [TaxId:1395981]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A088BEK2 (0-End)
      • engineered mutation (164)
      • engineered mutation (266)
      • engineered mutation (273)
      • engineered mutation (391)
    Domains in SCOPe 2.08: d6idda1, d6idda2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Shanghai/MH01/2013(H7N9)) [TaxId:1395981]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A088BEK2 (0-End)
      • engineered mutation (164)
      • engineered mutation (266)
      • engineered mutation (273)
      • engineered mutation (391)
    Domains in SCOPe 2.08: d6iddc1, d6iddc2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Shanghai/MH01/2013(H7N9)) [TaxId:1395981]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A088BEK2 (0-End)
      • engineered mutation (164)
      • engineered mutation (266)
      • engineered mutation (273)
      • engineered mutation (391)
    Domains in SCOPe 2.08: d6idde1, d6idde2
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Shanghai/MH01/2013(H7N9)) [TaxId:1395981]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A088BEK2 (0-End)
      • engineered mutation (164)
      • engineered mutation (266)
      • engineered mutation (273)
      • engineered mutation (391)
    Domains in SCOPe 2.08: d6iddg1, d6iddg2
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Shanghai/MH01/2013(H7N9)) [TaxId:1395981]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A088BEK2 (0-End)
      • engineered mutation (164)
      • engineered mutation (266)
      • engineered mutation (273)
      • engineered mutation (391)
    Domains in SCOPe 2.08: d6iddi1, d6iddi2
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Shanghai/MH01/2013(H7N9)) [TaxId:1395981]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A088BEK2 (0-End)
      • engineered mutation (164)
      • engineered mutation (266)
      • engineered mutation (273)
      • engineered mutation (391)
    Domains in SCOPe 2.08: d6iddk1, d6iddk2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iddA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgrglfgaiagfiengweglidgwygfrhqnaqgegtaadyk
    stqsaidqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaell
    vamenqhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydh
    skyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iddA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeglfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsa
    idqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaellvamen
    qhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyre
    eamqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6iddC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgrglfgaiagfiengweglidgwygfrhqnaqgegtaadyk
    stqsaidqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaell
    vamenqhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydh
    skyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iddC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpelfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsai
    dqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaellvamenq
    htidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyree
    amqn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6iddE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgrglfgaiagfiengweglidgwygfrhqnaqgegtaadyk
    stqsaidqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaell
    vamenqhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydh
    skyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iddE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpelfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsai
    dqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaellvamenq
    htidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyree
    amqn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6iddG (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgrglfgaiagfiengweglidgwygfrhqnaqgegtaadyk
    stqsaidqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaell
    vamenqhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydh
    skyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iddG (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpelfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsai
    dqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaellvamenq
    htidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyree
    amqn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6iddI (I:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgrglfgaiagfiengweglidgwygfrhqnaqgegtaadyk
    stqsaidqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaell
    vamenqhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydh
    skyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iddI (I:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpelfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsai
    dqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaellvamenq
    htidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyree
    amqn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6iddK (K:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgrglfgaiagfiengweglidgwygfrhqnaqgegtaadyk
    stqsaidqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaell
    vamenqhtidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydh
    skyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iddK (K:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpelfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsai
    dqitgklnrliektnqqfelidneftevekqignvinwtrdsitevwsynaellvamenq
    htidladsemdklyervkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyree
    amqn