PDB entry 6id6

View 6id6 on RCSB PDB site
Description: Crystal structure of Rv0731c from Mycobacterium tuberculosis at 1.63 Angstroms.
Class: transferase
Keywords: Methyltransferase, TRANSFERASE
Deposited on 2018-09-08, released 2019-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative S-adenosyl-L-methionine-dependent methyltransferase Rv0731c
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: Rv0731c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WFI5 (0-300)
      • expression tag (301)
    Domains in SCOPe 2.08: d6id6a1, d6id6a2
  • Heterogens: PGE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6id6A (A:)
    gdswdlassvgltatmvaaaravagrapgalvndqfaeplvravgvdffvrmasgeldpd
    elaedeanglrrfadamairthyfdnffldatragirqavilasgldsrayrlrwpagti
    vfevdqpqvidfktttlaglgaapttdrrtvavdlrddwptalqkagfdnaqrtawiaeg
    llgylsaeaqdrlldqitaqsvpgsqfatevlrdinrlneeelrgrmrrlaerfrrhgld
    ldmsglvyfgdrtdartyladhgwrtasasttdllaehglppidgddapfgeviyvsael
    ka