PDB entry 6icp

View 6icp on RCSB PDB site
Description: pseudomonas putida cbb5 ndma ql mutant with caffeine
Deposited on 2018-09-06, released 2019-09-04
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylxanthine N1-demethylase NdmA
    Species: Pseudomonas putida [TaxId:303]
    Gene: ndmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H9N289
      • engineered mutation (299)
      • engineered mutation (303)
  • Chain 'B':
    Compound: Methylxanthine N1-demethylase NdmA
    Species: Pseudomonas putida [TaxId:303]
    Gene: ndmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H9N289
      • engineered mutation (299)
      • engineered mutation (303)
  • Chain 'C':
    Compound: Methylxanthine N1-demethylase NdmA
    Species: Pseudomonas putida [TaxId:303]
    Gene: ndmA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H9N289
      • engineered mutation (299)
      • engineered mutation (303)
  • Heterogens: FES, FE, CFF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6icpA (A:)
    mgsshhhhhhenlyfqgsmeqaiindereylrhfwhpvctvtelekahpsslgplavkll
    neqlvvaklgdeyvamrdrcahrsaklslgtvsgnrlqcpyhgwqydthgacqlvpacpn
    spipnkakvdrfdceerygliwirldssfdcteipyfsaandprlriviqepywwdatae
    rrwenftdfshfafihpgtlfdpnnaeppivpmdrfngqfrfvydtpedmavpnqapigs
    fsytcsmpfainlevskysssslhvlfnvscpvdshttknflifareqsddsdylhiafq
    dlvlaedkpviesqwpkdapadevsvvadkvsiqyrkwlrelkeahkegsqafrsalldp
    viesdrsyi
    

    Sequence, based on observed residues (ATOM records):
    >6icpA (A:)
    ndereylrhfwhpvctvtelekahpsslgplavkllneqlvvaklgdeyvamrdrcahrs
    aklslgtvsgnrlqcpyhgwqydthgacqlvpacpnspipnkakvdrfdceerygliwir
    ldssfdcteipyfsaandprlriviqepywwdataerrwenftdfshfafihpgtlfdpn
    naeppivpmdrfngqfrfvydtppigsfsytcsmpfainlevskysssslhvlfnvscpv
    dshttknflifareqsddsdylhiafqdlvlaedkpviesqwpkdapadevsvvadkvsi
    qyrkwlrelkeahkegsqafrsalldpviesdrsy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6icpB (B:)
    mgsshhhhhhenlyfqgsmeqaiindereylrhfwhpvctvtelekahpsslgplavkll
    neqlvvaklgdeyvamrdrcahrsaklslgtvsgnrlqcpyhgwqydthgacqlvpacpn
    spipnkakvdrfdceerygliwirldssfdcteipyfsaandprlriviqepywwdatae
    rrwenftdfshfafihpgtlfdpnnaeppivpmdrfngqfrfvydtpedmavpnqapigs
    fsytcsmpfainlevskysssslhvlfnvscpvdshttknflifareqsddsdylhiafq
    dlvlaedkpviesqwpkdapadevsvvadkvsiqyrkwlrelkeahkegsqafrsalldp
    viesdrsyi
    

    Sequence, based on observed residues (ATOM records):
    >6icpB (B:)
    ndereylrhfwhpvctvtelekahpsslgplavkllneqlvvaklgdeyvamrdrcahrs
    aklslgtvsgnrlqcpyhgwqydthgacqlvpacpnspipnkakvdrfdceerygliwir
    ldssfdcteipyfsaandprlriviqepywwdataerrwenftdfshfafihpgtlfdpn
    naeppivpmdrfngqfrfvydtpigsfsytcsmpfainlevskysssslhvlfnvscpvd
    shttknflifareqsddsdylhiafqdlvlaedkpviesqwpkdapadevsvvadkvsiq
    yrkwlrelkeahkegsqafrsalldpviesdrsy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6icpC (C:)
    mgsshhhhhhenlyfqgsmeqaiindereylrhfwhpvctvtelekahpsslgplavkll
    neqlvvaklgdeyvamrdrcahrsaklslgtvsgnrlqcpyhgwqydthgacqlvpacpn
    spipnkakvdrfdceerygliwirldssfdcteipyfsaandprlriviqepywwdatae
    rrwenftdfshfafihpgtlfdpnnaeppivpmdrfngqfrfvydtpedmavpnqapigs
    fsytcsmpfainlevskysssslhvlfnvscpvdshttknflifareqsddsdylhiafq
    dlvlaedkpviesqwpkdapadevsvvadkvsiqyrkwlrelkeahkegsqafrsalldp
    viesdrsyi
    

    Sequence, based on observed residues (ATOM records):
    >6icpC (C:)
    ndereylrhfwhpvctvtelekahpsslgplavkllneqlvvaklgdeyvamrdrcahrs
    aklslgtvsgnrlqcpyhgwqydthgacqlvpacpnspipnkakvdrfdceerygliwir
    ldssfdcteipyfsaandprlriviqepywwdataerrwenftdfshfafihpgtlfdpn
    naeppivpmdrfngqfrfvydtpigsfsytcsmpfainlevskysssslhvlfnvscpvd
    shttknflifareqsddsdylhiafqdlvlaedkpviesqwpkdapadevsvvadkvsiq
    yrkwlrelkeahkegsqafrsalldpviesdrsy