PDB entry 6icc

View 6icc on RCSB PDB site
Description: The NZ-1 Fab complexed with the PDZ tandem fragment of A. aeolicus S2P homolog with the PA12 tag inserted between the residues 181 and 186
Class: signaling protein
Keywords: protease, SIGNALING PROTEIN
Deposited on 2018-09-05, released 2019-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PDZ tandem fragment with PA tag
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: aq_1964
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67776 (Start-68)
      • see sequence details (68)
      • see sequence details (68)
      • see sequence details (68)
      • see sequence details (68)
      • see sequence details (68)
      • see sequence details (68)
      • see sequence details (68)
    • Uniprot O67776 (81-187)
  • Chain 'H':
    Compound: Heavy chain of antigen binding fragment, Fab of NZ-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ICC (0-218)
    Domains in SCOPe 2.08: d6icch_
  • Chain 'L':
    Compound: Light chain of antigen binding fragment, Fab of NZ-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ICC (0-213)
    Domains in SCOPe 2.08: d6iccl1, d6iccl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6iccH (H:)
evqlvesggglvqpgrslklscaasgftfsnygmawvrqtptkglewiasisaggdktyy
gdsvkgrfsisrdnaktthylqmdslrsedtatyycaktsrvyfdywgqgvmvtvssaet
tapsvyplapgtalksnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsglyt
ltssvtvpsstwssqavtcnvahpasstkvdkkivprec

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6iccL (L:)
efvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhegrspttmiyrddkrpdgvp
drfsgsidrssnsalltinnvqtedeadyfchsyssgivfgggtkltvlgqpkstptltv
fppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkqgnkyiassfl
rltaeqwrsrnsftcqvthegntvekslspaecv