PDB entry 6icb

View 6icb on RCSB PDB site
Description: bovine calbindin d9k binding mn2+
Class: calcium-binding protein
Keywords: calcium-binding protein, ef-hand, manganese binding
Deposited on 1997-03-11, released 1997-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 1997-09-17, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.19
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Bos taurus
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6icba_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6icbA (A:)
mkspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdg
evsfeefqvlvkkisq