PDB entry 6ic7

View 6ic7 on RCSB PDB site
Description: Human cathepsin-C in complex with dipeptidyl cyclopropyl nitrile inhibitor 3
Class: hydrolase
Keywords: cathepsin-C, cysteine protease, structure-based drug design, arthritis, HYDROLASE
Deposited on 2018-12-02, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dipeptidyl peptidase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CTSC, CPPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (0-End)
  Domains in SCOPe 2.08: d6ic7a_
• Chain 'B':
  Compound: Dipeptidyl peptidase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CTSC, CPPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (0-161)
• Chain 'C':
  Compound: Dipeptidyl peptidase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CTSC, CPPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (Start-68)
• Heterogens: H9H, NAG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ic7A (A:)
  dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
  tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ic7A (A:)
  dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
  tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.