PDB entry 6ibn

View 6ibn on RCSB PDB site
Description: dye type peroxidase aa from streptomyces lividans: 32.8 kgy structure
Deposited on 2018-11-30, released 2019-07-31
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deferrochelatase/peroxidase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO2276
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RKQ2 (0-361)
      • conflict (173)
  • Chain 'B':
    Compound: Deferrochelatase/peroxidase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO2276
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RKQ2 (Start-361)
      • conflict (173)
  • Heterogens: HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ibnA (A:)
    gsavpfhgahqagiatpvqdrlhfaafdvttedraafvallkewtaaarrltaghavgeg
    aygglpeappddtgealglkpsrltltigfgpslftrfgladlrpealadlpkfpgdnld
    rarsggdlcvqacaddpqvavhairnlarigfgkvvvrwsqlgfgktssttpdkqtprnl
    lgfkdgtrniagtekdrldrfvwaaekdgtpwmtggsylvarrirmhietwdraslqeqe
    dvfgrdkgegapvgkakerdepflkamkpdahvrlahpdsnggatllrrgysftdgtdgl
    grldaglfflayqrdirtgfvpvqrnlatdalneyiqhvgsavfavppgvrdaddwwgst
    lf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ibnB (B:)
    gsavpfhgahqagiatpvqdrlhfaafdvttedraafvallkewtaaarrltaghavgeg
    aygglpeappddtgealglkpsrltltigfgpslftrfgladlrpealadlpkfpgdnld
    rarsggdlcvqacaddpqvavhairnlarigfgkvvvrwsqlgfgktssttpdkqtprnl
    lgfkdgtrniagtekdrldrfvwaaekdgtpwmtggsylvarrirmhietwdraslqeqe
    dvfgrdkgegapvgkakerdepflkamkpdahvrlahpdsnggatllrrgysftdgtdgl
    grldaglfflayqrdirtgfvpvqrnlatdalneyiqhvgsavfavppgvrdaddwwgst
    lf
    

    Sequence, based on observed residues (ATOM records):
    >6ibnB (B:)
    savpfhgahqagiatpvqdrlhfaafdvttedraafvallkewtaaarrltaghavgega
    ygglpeappddtgealglkpsrltltigfgpslftrfgladlrpealadlpkfpgdnldr
    arsggdlcvqacaddpqvavhairnlarigfgkvvvrwsqlgfgktssttpdkqtprnll
    gfkdgtrniagtekdrldrfvwaaekdgtpwmtggsylvarrirmhietwdraslqeqed
    vfgrdkgegapvgkakerdepflkamkpdahvrlahpdsnggatllrrgysftdgtdglg
    rldaglfflayqrdirtgfvpvqrnlatdalneyiqhvgsavfavppgvrdaddwwgstl
    f