PDB entry 6ibl

View 6ibl on RCSB PDB site
Description: ACTIVATED TURKEY BETA1 ADRENOCEPTOR WITH BOUND AGONIST FORMOTEROL AND NANOBODY Nb80
Class: immune system
Keywords: Beta1 Adrenoceptor, Activated, Agonist, Nanobody, immune system
Deposited on 2018-11-30, released 2019-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1,Beta-1 adrenergic receptor
    Species: Meleagris gallopavo [TaxId:9103]
    Gene: ADRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered mutation (31)
      • engineered mutation (34)
      • linker (108)
      • linker (111-113)
    • Uniprot P07700 (114-End)
      • conflict (138)
      • conflict (160)
      • conflict (186)
      • engineered mutation (326)
      • engineered mutation (369)
      • engineered mutation (380)
      • engineered mutation (400)
  • Chain 'B':
    Compound: Thioredoxin 1,Beta-1 adrenergic receptor
    Species: Meleagris gallopavo [TaxId:9103]
    Gene: ADRB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered mutation (31)
      • engineered mutation (34)
      • linker (108)
      • linker (111-113)
    • Uniprot P07700 (114-End)
      • conflict (138)
      • conflict (160)
      • conflict (186)
      • engineered mutation (326)
      • engineered mutation (369)
      • engineered mutation (380)
      • engineered mutation (400)
  • Chain 'C':
    Compound: Camelid antibody fragment Nb80
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IBL (Start-120)
    Domains in SCOPe 2.08: d6iblc1, d6iblc2
  • Chain 'D':
    Compound: Camelid antibody fragment Nb80
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IBL (Start-120)
    Domains in SCOPe 2.08: d6ibld1, d6ibld2
  • Heterogens: H98, NA, 2CV, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6iblC (C:)
    sqvqlqesggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstny
    ansvkgrftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iblC (C:)
    vqlqesggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstnyan
    svkgrftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6iblD (D:)
    sqvqlqesggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstny
    ansvkgrftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iblD (D:)
    qvqlqesggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstnya
    nsvkgrftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvss