PDB entry 6ib6

View 6ib6 on RCSB PDB site
Description: solution structure of the water-soluble lu-domain of human lypd6 protein
Deposited on 2018-11-29, released 2019-12-18
The last revision was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ly6/PLAUR domain-containing protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPD6, UNQ3023/PRO9821
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86Y78 (1-95)
      • initiating methionine (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ib6A (A:)
mfkcftcekaadnyecnrwapdiycpretrycytqhtmevtgnsisvtkrcvpleeclst
gcrdseheghkvctsccegnicnlplprnetdatfa