PDB entry 6iav

View 6iav on RCSB PDB site
Description: co-azurin from pseudomonas aeruginosa treated with hydrosulfide
Class: electron transport
Keywords: cobalt protein, hydrosulfide sensor, electron transport
Deposited on 2018-11-27, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iava_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iavb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iavc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6iavd_
  • Heterogens: CO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iavA (A:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iavB (B:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iavC (C:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6iavD (D:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalm
    kgtltlk