PDB entry 6iam

View 6iam on RCSB PDB site
Description: modulating protein-protein interactions with visible light peptide backbone switches
Deposited on 2018-11-27, released 2019-02-06
The last revision was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR5, BIG3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ser-ala-arg-ala-xy5-val-his-leu-arg-lys-ser-ala
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IAM (0-11)
  • Chain 'C':
    Compound: Small ubiquitin-related modifier 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1P1, SUMO5, UBL2, UBL6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: K, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6iamA (A:)
tpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghkl
gisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgs
fdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclkt
lidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsv
tggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktik
lwksdc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6iamB (B:)
saraxvhlrksa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6iamC (C:)
eakp