PDB entry 6iak

View 6iak on RCSB PDB site
Description: the crystal structure of the chicken creb3 bzip
Deposited on 2018-11-26, released 2019-12-11
The last revision was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: XRAY
Resolution: 3.95 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Uncharacterized protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CREB3
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iakA (A:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakA (A:)
    rllkkvrrkirnkqsaqdsrrrkkiyvdglenrvaactaqnhelqkkvqllqkqnmslle
    qlrklqal
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6iakB (B:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakB (B:)
    rkirnkqsaqdsrrrkkiyvdglenrvaactaqnhelqkkvqllqkqnmslleqlrklqa
    lv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6iakC (C:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakC (C:)
    vrrkirnkqsaqdsrrrkkiyvdglenrvaactaqnhelqkkvqllqkqnmslleqlrkl
    q
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6iakD (D:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakD (D:)
    kkvrrkirnkqsaqdsrrrkkiyvdglenrvaactaqnhelqkkvqllqkqnmslleqlr
    kl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6iakE (E:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakE (E:)
    erllkkvrrkirnkqsaqdsrrrkkiyvdglenrvaactaqnhelqkkvqllqkqnmsll
    eqlrklq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6iakF (F:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakF (F:)
    tkaeerllkkvrrkirnkqsaqdsrrrkkiyvdglenrvaactaqnhelqkkvqllqkqn
    mslleqlrklq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6iakG (G:)
    magpeplaalpdgdlldfllnddapaagspagdgpllgdwvlpelelldkemdsfissll
    spsedepcllqgclpadsdsstsedqnpfhssgsdvasspqssdivqfdhnyslhqdwpa
    lesvrsdmaegdvsidletwmclegtnetlqescsfpvtvavdagpqlmpgapmqsnfpe
    lvlteeerqllekdgvslptclpltkaeerllkkvrrkirnkqsaqdsrrrkkiyvdgle
    nrvaactaqnhelqkkvqllqkqnmslleqlrklqalvrqsttktttastcimvlvlsfc
    lilspslysfgsrgpqpefrvlsrqirefpnkvwqaapavqeevvlerlspepedtslgs
    lnqsreegqsppkpdprsafngnsssdppagselghpqpqeqqsrrdalhsevlapwkde
    nqewverttsvviqqhrtdem
    

    Sequence, based on observed residues (ATOM records):
    >6iakG (G:)
    irnkqsaqdsrrrkkiyvdglenrvaactaqnhelqk