PDB entry 6i9y

View 6i9y on RCSB PDB site
Description: The 2.14 A X-ray crystal structure of Sporosarcina pasteurii urease in complex with Au(I) ions
Class: hydrolase
Keywords: urease, nickel, gold compounds, metal-based ndrugs, HYDROLASE
Deposited on 2018-11-26, released 2019-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Urease subunit gamma
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YGY5 (0-99)
  Domains in SCOPe 2.08: d6i9ya_
• Chain 'B':
  Compound: urease subunit beta
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41021 (0-121)
  Domains in SCOPe 2.08: d6i9yb_
• Chain 'C':
  Compound: urease subunit alpha
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YL32 (0-569)
• Heterogens: EDO, SO4, NI, OH, AU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6i9yA (A:)
  mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
  khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6i9yB (B:)
  nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
  rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
  ve
  

  
  
• Chain 'C':
  No sequence available.