PDB entry 6i9t

View 6i9t on RCSB PDB site
Description: Two minutes iron loaded Rana Catesbeiana H' ferritin variant H54N
Class: oxidoreductase
Keywords: Rana Catesbeiana H' ferritin, ferroxidase process, H54N variant, two minutes iron loaded, time-controlled iron loading, OXIDOREDUCTASE
Deposited on 2018-11-25, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Lithobates catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (54)
    Domains in SCOPe 2.07: d6i9ta_
  • Heterogens: FE2, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i9tA (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkensheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i9tA (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkensheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes