PDB entry 6i9p

View 6i9p on RCSB PDB site
Description: Iron-free state of Rana catesbeiana H' ferritin variant H54N
Class: oxidoreductase
Keywords: Rana Catesbeiana H' ferritin, ferroxidase process, H54N variant, iron-free state, OXIDOREDUCTASE
Deposited on 2018-11-24, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Lithobates catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6i9pa_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i9pA (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkensheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i9pA (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkensheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes