PDB entry 6i9j

View 6i9j on RCSB PDB site
Description: Human transforming growth factor beta2 in a tetragonal crystal form
Class: cytokine
Keywords: growth factor, cysteine-knot cytokines, small proteins, TGF-beta2, cell growth, CYTOKINE
Deposited on 2018-11-23, released 2019-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transforming growth factor beta-2 proprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i9ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6i9jA (A:)
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs