PDB entry 6i8g

View 6i8g on RCSB PDB site
Description: Structure of the plant immune signaling node EDS1 (enhanced disease susceptibility 1) in complex with nanobody ENB73
Class: immune system
Keywords: enhanced disease susceptibility 1, plant innate immune system, alpha/beta hydrolase fold, nanobody, IMMUNE SYSTEM
Deposited on 2018-11-20, released 2019-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein EDS1L
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: EDS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: EDS1-specific nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I8G (0-End)
    Domains in SCOPe 2.08: d6i8gb1, d6i8gb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6i8gB (B:)
qvqlqesggglvqaggslrlscatsthtagqytmawfrqapgkerefvavlrwsdystdy
ansvknrftisrdnakntvylqmnslkpedtavyycaagwpvkvissadeyinwgqgtqv
tvssaaaypydvpdygshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6i8gB (B:)
qvqlqesggglvqaggslrlscatsthtagqytmawfrqapgkerefvavlrwsdystdy
ansvknrftisrdnakntvylqmnslkpedtavyycaagwpvkvissadeyinwgqgtqv
tvssaa