PDB entry 6i8c

View 6i8c on RCSB PDB site
Description: Crystal structure of the murine beta-2-microglobulin
Class: immune system
Keywords: MHC class I, beta-2-microglobulin, protein aggregation, immune system
Deposited on 2018-11-20, released 2019-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (0-End)
      • variant (84)
    Domains in SCOPe 2.08: d6i8ca_
  • Heterogens: MET, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i8cA (A:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i8cA (A:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrd