PDB entry 6i80

View 6i80 on RCSB PDB site
Description: Crystal Structure of the second bromodomain of BRD2 in complex with RT53
Class: transcription
Keywords: BET, Bromodomain, RT53, inhibitor, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2018-11-19, released 2019-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (2-109)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6i80a1, d6i80a2
  • Chain 'B':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (2-109)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6i80b1, d6i80b2
  • Heterogens: H7B, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6i80A (A:)
    smeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6i80B (B:)
    smeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd