PDB entry 6i80
View 6i80 on RCSB PDB site
Description: Crystal Structure of the second bromodomain of BRD2 in complex with RT53
Class: transcription
Keywords: BET, Bromodomain, RT53, inhibitor, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on
2018-11-19, released
2019-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-11-27, with a file datestamp of
2019-11-22.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.71
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain-containing protein 2
Species: Homo sapiens [TaxId:9606]
Gene: BRD2, KIAA9001, RING3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6i80a1, d6i80a2 - Chain 'B':
Compound: Bromodomain-containing protein 2
Species: Homo sapiens [TaxId:9606]
Gene: BRD2, KIAA9001, RING3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6i80b1, d6i80b2 - Heterogens: H7B, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6i80A (A:)
smeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6i80B (B:)
smeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd