PDB entry 6i7d

View 6i7d on RCSB PDB site
Description: plasmodium falciparum myosin a, post-rigor and rigor-like states
Deposited on 2018-11-16, released 2019-08-07
The last revision was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-A
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0233
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myosin-A
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0233
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Myosin-A
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0233
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Myosin-A
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0233
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SEP, EDO, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i7dA (A:)
    mavtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqg
    skkekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhr
    ylknqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhg
    vnksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnakti
    rnnnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganst
    mkskfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagil
    tlgnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkie
    grwnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknns
    leqlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvls
    yledqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllk
    nkdvlrgdlvevikdspnpivqqlfegqviekgkiakgsligsqflnqltslmnlinste
    phfircikpnenkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfvd
    iaaaedssvenqnkcvnilklsglsesmykigksmvflkqegakiltk
    

    Sequence, based on observed residues (ATOM records):
    >6i7dA (A:)
    vtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqgsk
    kekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhryl
    knqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhgvn
    ksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnaktirn
    nnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganstmk
    skfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagiltl
    gnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkiegr
    wnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknnsle
    qlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvlsyl
    edqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllknk
    dvlrgdlvevikdspnpivqqlfegqviekgkiakgsligsqflnqltslmnlinsteph
    fircikpnenkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfaaed
    ssvenqnkcvnilklsglsesmykigksmvflkqegakiltk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i7dB (B:)
    mavtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqg
    skkekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhr
    ylknqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhg
    vnksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnakti
    rnnnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganst
    mkskfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagil
    tlgnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkie
    grwnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknns
    leqlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvls
    yledqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllk
    nkdvlrgdlvevikdspnpivqqlfegqviekgkiakgsligsqflnqltslmnlinste
    phfircikpnenkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfvd
    iaaaedssvenqnkcvnilklsglsesmykigksmvflkqegakiltk
    

    Sequence, based on observed residues (ATOM records):
    >6i7dB (B:)
    vtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqgsk
    kekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhryl
    knqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhgvn
    ksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnaktirn
    nnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganstmk
    skfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagiltl
    gnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkiegr
    wnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknnsle
    qlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvlsyl
    edqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllknk
    dvlrgdlvevikdspnpivqqlfegqvigkiakgsligsqflnqltslmnlinstephfi
    rcikpnenkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfsvenqn
    kcvnilklsglsesmykigksmvflkqegakiltk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6i7dC (C:)
    mavtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqg
    skkekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhr
    ylknqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhg
    vnksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnakti
    rnnnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganst
    mkskfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagil
    tlgnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkie
    grwnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknns
    leqlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvls
    yledqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllk
    nkdvlrgdlvevikdspnpivqqlfegqviekgkiakgsligsqflnqltslmnlinste
    phfircikpnenkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfvd
    iaaaedssvenqnkcvnilklsglsesmykigksmvflkqegakiltk
    

    Sequence, based on observed residues (ATOM records):
    >6i7dC (C:)
    avtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqgs
    kkekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhry
    lknqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhgv
    nksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnaktir
    nnnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganstm
    kskfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagilt
    lgnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvegrwnkndae
    vlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknnsleqlfinit
    nemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvlsyledqclap
    ggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllknkdvlrgdl
    vevikdspnpivqqlfegqviiakgsligsqflnqltslmnlinstephfircikpnenk
    kplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfvdiaaaedssvenqn
    kcvnilklsglsesmykigksmvflkqegakiltk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6i7dD (D:)
    mavtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqg
    skkekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhr
    ylknqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhg
    vnksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnakti
    rnnnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganst
    mkskfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagil
    tlgnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkie
    grwnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknns
    leqlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvls
    yledqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllk
    nkdvlrgdlvevikdspnpivqqlfegqviekgkiakgsligsqflnqltslmnlinste
    phfircikpnenkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfvd
    iaaaedssvenqnkcvnilklsglsesmykigksmvflkqegakiltk
    

    Sequence, based on observed residues (ATOM records):
    >6i7dD (D:)
    avtneeiktaskivrrvsnveafdksgsvfkgyqiwtdisptiendpnimfvkcvvqqgs
    kkekltvvqidppgtgtpydidpthawncnsqvdpmsfgdigllnhtnipcvldflkhry
    lknqiyttavplivainpykdlgnttnewirryrdtadhtklpphvftcarealsnlhgv
    nksqtiivsgesgagkteatkqimryfassksgnmdlriqtaimaanpvleafgnaktir
    nnnssrfgrfmqlvisheggirygsvvaflleksriitqddnersyhifyqflkganstm
    kskfglkgvteykllnpnstevsgvddvkdfeevieslknmelsesdievifsivagilt
    lgnvrliekqeaglsdaaaimdedmgvfnkacelmyldpelikreilikvtvaggtkieg
    rwnkndaevlksslckamyeklflwiirhlnsriepeggfktfmgmldifgfevfknnsl
    eqlfinitnemlqknfvdivferesklykdegistaelkytsnkevinvlcekgksvlsy
    ledqclapggtdekfvsscatnlkennkftpakvasnknfiiqhtigpiqycaesfllkn
    kdvlrgdlvevikdspnpivqqlfeakgsligsqflnqltslmnlinstephfircikpn
    enkkplewcepkiliqlhalsilealvlrqlgysyrrtfeeflyqykfvdiaaaedssve
    nqnkcvnilklsglsesmykigksmvflkqegakiltk