PDB entry 6i72

View 6i72 on RCSB PDB site
Description: Structure of Fragaria ananassa O-methyltransferase in complex with S-adenosylhomocysteine and caffeic acid
Class: transferase
Keywords: fruit ripening, strawberry, volatiles, O-methyltransferase, SAM, SAH, caffeic acid, ferulic acid, protocatechuic aldehyde, vanillin, furaneol, furaneol methyl ether, TRANSFERASE
Deposited on 2018-11-15, released 2019-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-methyltransferase
    Species: Fragaria ananassa [TaxId:3747]
    Gene: omt1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i72a1, d6i72a2
  • Chain 'B':
    Compound: O-methyltransferase
    Species: Fragaria ananassa [TaxId:3747]
    Gene: omt1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i72b1, d6i72b2
  • Heterogens: DHC, SAH, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i72A (A:)
    mkhhhhhhgavsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdla
    sqlptknpeapvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltknedgvs
    iaalclmnqdkvlveswyhlkdavldggipfnkaygmtafdyhgtdprfnkvfnkgmadh
    stitmkkiletykgfeglksivdvgggtgavvnmivskypsikginfdlphviedapqyp
    gvqhvggdmfvsvpkgnaifmkwichdwsdehcikflkncyaalpddgkvilaecilpva
    pdtslatkgvvhmdvimlahnpggkerteqefealakgsgfqgirvccdafntyvieflk
    ki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i72A (A:)
    vsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdlasqlptknpea
    pvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltknedgvsiaalclmnqd
    kvlveswyhlkdavldggipfnkaygmtafdyhgtdprfnkvfnkgmadhstitmkkile
    tykgfeglksivdvgggtgavvnmivskypsikginfdlphviedapqypgvqhvggdmf
    vsvpkgnaifmkwichdwsdehcikflkncyaalpddgkvilaecilpvapdtslatkgv
    vhmdvimlahnpggkerteqefealakgsgfqgirvccdafntyvieflkki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6i72B (B:)
    mkhhhhhhgavsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdla
    sqlptknpeapvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltknedgvs
    iaalclmnqdkvlveswyhlkdavldggipfnkaygmtafdyhgtdprfnkvfnkgmadh
    stitmkkiletykgfeglksivdvgggtgavvnmivskypsikginfdlphviedapqyp
    gvqhvggdmfvsvpkgnaifmkwichdwsdehcikflkncyaalpddgkvilaecilpva
    pdtslatkgvvhmdvimlahnpggkerteqefealakgsgfqgirvccdafntyvieflk
    ki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i72B (B:)
    vsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdlasqlptknpea
    pvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltknedgvsiaalclmnqd
    kvlveswyhlkdavldggipfnkaygmtafdyhgtdprfnkvfnkgmadhstitmkkile
    tykgfeglksivdvgggtgavvnmivskypsikginfdlphviedapqypgvqhvggdmf
    vsvpkgnaifmkwichdwsdehcikflkncyaalpddgkvilaecilpvapdtslatkgv
    vhmdvimlahnpggkerteqefealakgsgfqgirvccdafntyvieflkki