PDB entry 6i6u

View 6i6u on RCSB PDB site
Description: circular permutant of ribosomal protein s6, adding 9aa to n terminal of p81-82, l75a mutant
Deposited on 2018-11-15, released 2019-11-27
The last revision was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6,30S ribosomal protein S6
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: rpsF, TTHA0245
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (Start-19)
      • linker (20-25)
    • Uniprot Q5SLP8 (26-104)
  • Chain 'B':
    Compound: 30S ribosomal protein S6,30S ribosomal protein S6
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: rpsF, TTHA0245
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (1-19)
      • initiating methionine (0)
      • engineered mutation (3)
      • linker (20-25)
    • Uniprot Q5SLP8 (26-104)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i6uA (A:)
mndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralenygar
vekveelglrrlaypiakdpqgyflwyqvempedrvndlarelri

    Sequence, based on observed residues (ATOM records):
    >6i6uA (A:)
elrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralenygarvekvee
lglrrlaypiakdpqgyflwyqvempedrvndlarelri

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6i6uB (B:)
mndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralenygar
vekveelglrrlaypiakdpqgyflwyqvempedrvndlarelri