PDB entry 6i6s
View 6i6s on RCSB PDB site
Description: circular permutant of ribosomal protein s6, adding 9aa to c terminal of p68-69, l75a mutant
Deposited on
2018-11-15, released
2019-11-27
The last revision was dated
2020-12-09, with a file datestamp of
2020-12-04.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.59
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6
Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
Gene: rpsF, TTHA0245
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLP8 (1-23)
- PDB 6I6S (24-29)
- Uniprot Q5SLP8 (30-End)
- Chain 'B':
Compound: 30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6
Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
Gene: rpsF, TTHA0245
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SLP8 (1-23)
- initiating methionine (0)
- engineered mutation (7)
- PDB 6I6S (24-29)
- Uniprot Q5SLP8 (30-End)
- Heterogens: K, NA, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence, based on SEQRES records:
>6i6sA (A:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvempedrvndlar
Sequence, based on observed residues (ATOM records):
>6i6sA (A:)
edrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqraleny
garvekveelglrrlaypiakdpqgyflwyqvempe
- Chain 'B':
Sequence, based on SEQRES records:
>6i6sB (B:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvempedrvndlar
Sequence, based on observed residues (ATOM records):
>6i6sB (B:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvemp