PDB entry 6i6s

View 6i6s on RCSB PDB site
Description: circular permutant of ribosomal protein s6, adding 9aa to c terminal of p68-69, l75a mutant
Deposited on 2018-11-15, released 2019-11-27
The last revision was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: rpsF, TTHA0245
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (1-23)
      • engineered mutation (7)
    • PDB 6I6S (24-29)
    • Uniprot Q5SLP8 (30-End)
  • Chain 'B':
    Compound: 30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6,30S ribosomal protein S6
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: rpsF, TTHA0245
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (1-23)
      • initiating methionine (0)
      • engineered mutation (7)
    • PDB 6I6S (24-29)
    • Uniprot Q5SLP8 (30-End)
  • Heterogens: K, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i6sA (A:)
    medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
    ygarvekveelglrrlaypiakdpqgyflwyqvempedrvndlar
    

    Sequence, based on observed residues (ATOM records):
    >6i6sA (A:)
    edrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqraleny
    garvekveelglrrlaypiakdpqgyflwyqvempe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i6sB (B:)
    medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
    ygarvekveelglrrlaypiakdpqgyflwyqvempedrvndlar
    

    Sequence, based on observed residues (ATOM records):
    >6i6sB (B:)
    medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
    ygarvekveelglrrlaypiakdpqgyflwyqvemp