PDB entry 6i6l

View 6i6l on RCSB PDB site
Description: papaver somniferum o-methyltransferase 1
Deposited on 2018-11-15, released 2019-03-27
The last revision was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-methyltransferase 1
    Species: Papaver somniferum [TaxId:3469]
    Gene: MT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: O-methyltransferase 1
    Species: Papaver somniferum [TaxId:3469]
    Gene: MT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3PLQ5 (Start-392)
      • engineered mutation (116-117)
  • Heterogens: H68, SAH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i6lA (A:)
    gpamatngeifntyghnhqsatvtkitasnessngvcylsetanlgklicipmalraame
    lnvfqliskfgtdakvsaseiaskmpnaknnpeaamyldrilrllgassilsvsttaasi
    nrggddvvvheklygltnsscclvprqedgvslveellftsdkvvvdsffklkcvveekd
    svpfevahgakifeyaateprmnqvfndgmavfsivvfeavfrvydgfldmkelldvggg
    igtsvskivakyplirgvnfdlphvisvapqypgvehvagdmfeevpkgqnmllkwvlhd
    wgdercvkllkncwnslpvggkvliiefvlpnelgnnaesfnalipdlllmalnpggker
    tiseyddlgkaagfiktipipisnglhviefhk
    

    Sequence, based on observed residues (ATOM records):
    >6i6lA (A:)
    cylsetanlgklicipmalraamelnvfqliskfgtdakvsaseiaskmpnaknnpeaam
    yldrilrllgassilsvsteklygltnsscclvprqedgvslveellftsdkvvvdsffk
    lkcvveekdsvpfevahgakifeyaateprmnqvfndgmavfsivvfeavfrvydgfldm
    kelldvgggigtsvskivakyplirgvnfdlphvisvapqypgvehvagdmfeevpkgqn
    mllkwvlhdwgdercvkllkncwnslpvggkvliiefvlpnelgnnaesfnalipdlllm
    alnpggkertiseyddlgkaagfiktipipisnglhviefhk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i6lB (B:)
    gpamatngeifntyghnhqsatvtkitasnessngvcylsetanlgklicipmalraame
    lnvfqliskfgtdakvsaseiaskmpnaknnpeaamyldrilrllgassilsvsttaasi
    nrggddvvvheklygltnsscclvprqedgvslveellftsdkvvvdsffklkcvveekd
    svpfevahgakifeyaateprmnqvfndgmavfsivvfeavfrvydgfldmkelldvggg
    igtsvskivakyplirgvnfdlphvisvapqypgvehvagdmfeevpkgqnmllkwvlhd
    wgdercvkllkncwnslpvggkvliiefvlpnelgnnaesfnalipdlllmalnpggker
    tiseyddlgkaagfiktipipisnglhviefhk
    

    Sequence, based on observed residues (ATOM records):
    >6i6lB (B:)
    cylsetanlgklicipmalraamelnvfqliskfgtdakvsaseiaskmpnaknnpeaam
    yldrilrllgassilsvsttaasindvvvheklygltnsscclvprqedgvslveellft
    sdkvvvdsffklkcvveekdsvpfevahgakifeyaateprmnqvfndgmavfsivvfea
    vfrvydgfldmkelldvgggigtsvskivakyplirgvnfdlphvisvapqypgvehvag
    dmfeevpkgqnmllkwvlhdwgdercvkllkncwnslpvggkvliiefvlpnelgnnaes
    fnalipdlllmalnpggkertiseyddlgkaagfiktipipisnglhviefhk