PDB entry 6i6j

View 6i6j on RCSB PDB site
Description: crystal structure of the kdel receptor bound to synthetic nanobody.
Deposited on 2018-11-15, released 2019-02-27
The last revision was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ER lumen protein-retaining receptor 2
    Species: Gallus gallus [TaxId:9031]
    Gene: KDELR2, RCJMB04_8l23
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sybody
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6I6J (0-120)
  • Heterogens: OLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6i6jA (A:)
mnifrltgdlshlaaiiilllkiwksrscagisgksqllfalvfttryldlftsfislyn
tsmkliyiacsyatvyliymkfkatydgnhdtfrveflivpvgglsflvnhdfspleilw
tfsiylesvailpqlfmisktgeaetitthylfflglyralylvnwiwryyfegffdlia
vvagvvqtvlycdffylyvtkvlk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6i6jC (C:)
qvqlvesggglvqaggslrlscaasgfpvkrwsmtwyrqapgkerewvaairsaghwthy
adsvkgrftisrdnakntvylqmnslkpedtavyycnvkdegdfsywydywgqgtqvtvs
a