PDB entry 6i6i

View 6i6i on RCSB PDB site
Description: circular permutant of ribosomal protein s6, adding 6aa to c terminal of p68-69, l75a mutant
Deposited on 2018-11-15, released 2019-11-27
The last revision was dated 2020-12-23, with a file datestamp of 2020-12-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6,30S ribosomal protein S6
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: rpsF, rps6, TT_C1740
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (1-23)
      • initiating methionine (0)
      • conflict (7)
      • linker (24-29)
    • Uniprot P62666 (30-End)
  • Chain 'B':
    Compound: 30S ribosomal protein S6,30S ribosomal protein S6
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: rpsF, rps6, TT_C1740
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (1-23)
      • initiating methionine (0)
      • conflict (7)
      • linker (24-29)
    • Uniprot P62666 (30-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i6iA (A:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvempedrvnd

    Sequence, based on observed residues (ATOM records):
    >6i6iA (A:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvemp

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i6iB (B:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvempedrvnd

    Sequence, based on observed residues (ATOM records):
    >6i6iB (B:)
medrvndaarelrirdnvrrvmvvasttpgryevnivlnpnldqsqlalekeiiqralen
ygarvekveelglrrlaypiakdpqgyflwyqvemp