PDB entry 6i69

View 6i69 on RCSB PDB site
Description: circular permutant of ribosomal protein s6, adding 5aa to c terminal of p97-3, l10a mutant
Deposited on 2018-11-15, released 2019-11-27
The last revision was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: rpsF, TTHA0245
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP8 (1-94)
      • initiating methionine (0)
      • conflict (8)
      • conflict (90)
      • conflict (92-93)
      • expression tag (95)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i69A (A:)
    mryevnivanpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyfl
    wyqvempedrvndlarelrirdnvrrvmvvasttpgryevn
    

    Sequence, based on observed residues (ATOM records):
    >6i69A (A:)
    mryevnivanpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyfl
    wyqvempedrvndlarelrirdnvrrvmvvasttpg