PDB entry 6i5b

View 6i5b on RCSB PDB site
Description: crystal structure of outer cell wall cytochrome ocwa
Deposited on 2018-11-13, released 2019-09-25
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Thermincola potens (strain JR) [TaxId:635013]
    Gene: TherJR_2595
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Thermincola potens (strain JR) [TaxId:635013]
    Gene: TherJR_2595
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, BU3, HEC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i5bA (A:)
    ekpadsgpavaqnteyvgdeacktchsdvhsawsetshgnfikdvtkdpkalpgnfegny
    pkmlnfkaediqyvllgkpgalkvqelvgkkgtfgvpaddypvmwaswdagkgeweieve
    aigegtpwlstcagchvtgltvptdknpkaakafagfgitceqchgpgakhiknpqgekm
    visydaencgqchsrgdsvaktpdgkpfgypyndegqyvpgkkladyytvvsvegdkegk
    lfwptkhaknshhlqypewlmtghataletlkgnghaqdrclkchsaeaylakegttvtm
    ndaklgvtcqvchashdpaatkeaflrkpkteictqchnaeggivagkevhhphkemneg
    kiglgfpdspsvmykagvtcvdchmpktagpkashlmkvvmpkdgkangmpdscsschpg
    asqdylqnvidtwqndikgrlakvkakldakkaaansqaykealtyysivaadgsngvhn
    ydlavklltaaeqklqkgelklegkpipdpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6i5bA (A:)
    nteyvgdeacktchsdvhsawsetshgnfikdvtkdpkalpgnfegnypkmlnfkaediq
    yvllgkpgalkvqelvgkkgtfgvpaddypvmwaswdagkgeweieveaigegtpwlstc
    agchvtgltvptdknpkaakafagfgitceqchgpgakhiknpqgekmvisydaencgqc
    hsrgdsvaktpdgkpfgypyndegqyvpgkkladyytvvsvegdkegklfwptkhaknsh
    hlqypewlmtghataletlkgnghaqdrclkchsaeaylakegttvtmndaklgvtcqvc
    hashdpaatkeaflrkpkteictqchnaeggivagkevhhphkemnegkiglgfpdspsv
    mykagvtcvdchmpktagpkashlmkvvmpkdgkangmpdscsschpgasqdylqnvidt
    wqndikgrlakvkakldakkaaansqaykealtyysivaadgsngvhnydlavklltaae
    qklq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i5bB (B:)
    ekpadsgpavaqnteyvgdeacktchsdvhsawsetshgnfikdvtkdpkalpgnfegny
    pkmlnfkaediqyvllgkpgalkvqelvgkkgtfgvpaddypvmwaswdagkgeweieve
    aigegtpwlstcagchvtgltvptdknpkaakafagfgitceqchgpgakhiknpqgekm
    visydaencgqchsrgdsvaktpdgkpfgypyndegqyvpgkkladyytvvsvegdkegk
    lfwptkhaknshhlqypewlmtghataletlkgnghaqdrclkchsaeaylakegttvtm
    ndaklgvtcqvchashdpaatkeaflrkpkteictqchnaeggivagkevhhphkemneg
    kiglgfpdspsvmykagvtcvdchmpktagpkashlmkvvmpkdgkangmpdscsschpg
    asqdylqnvidtwqndikgrlakvkakldakkaaansqaykealtyysivaadgsngvhn
    ydlavklltaaeqklqkgelklegkpipdpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6i5bB (B:)
    teyvgdeacktchsdvhsawsetshgnfikdvtkdpkalpgnfegnypkmlnfkaediqy
    vllgkpgalkvqelvgkkgtfgvpaddypvmwaswdagkgeweieveaigegtpwlstca
    gchvtgltvptdknpkaakafagfgitceqchgpgakhiknpqgekmvisydaencgqch
    srgdsvaktpdgkpfgypyndegqyvpgkkladyytvvsvegdkegklfwptkhaknshh
    lqypewlmtghataletlkgnghaqdrclkchsaeaylakegttvtmndaklgvtcqvch
    ashdpaatkeaflrkpkteictqchnaeggivagkevhhphkemnegkiglgfpdspsvm
    ykagvtcvdchmpktagpkashlmkvvmpkdgkangmpdscsschpgasqdylqnvidtw
    qndikgrlakvkakldakkaaansqaykealtyysivaadgsngvhnydlavklltaaeq
    klq