PDB entry 6i57

View 6i57 on RCSB PDB site
Description: NMR structure of the third TPR domain of the human SPAG1 protein
Class: chaperone
Keywords: HSP70, HSP90, ATPase, GTPase, EEVD, MD simulation, RUVBL, R2TP, R2SP, cilia, dynein, assembly factor, CHAPERONE
Deposited on 2018-11-13, released 2019-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sperm-associated antigen 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SPAG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07617 (4-124)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6i57a1, d6i57a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6i57A (A:)
    gphmtfkalkeegnqcvndknykdalskyseclkinnkecaiytnralcylklcqfeeak
    qdcdqalqladgnvkafyrralahkglknyqkslidlnkvilldpsiieakmeleevtrl
    lnlkd