PDB entry 6i55

View 6i55 on RCSB PDB site
Description: Plasmodium falciparum dihydroorotate dehydrogenase (DHODH) co-crystallized with N-(2,2-Diphenylethyl)-4-hydroxy-1,2,5-thiadiazole-3-carboxamide
Class: oxidoreductase
Keywords: dhodh, plasmodium falciparum, oxidoreductase, inhibitor complex
Deposited on 2018-11-12, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: dhod
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6i55a_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: dhod
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6i55b_
  • Heterogens: FMN, ORO, DZB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i55A (A:)
    mhhhhhhssgvdlgtenlyfqsmfesynpefflydiflkfclkyidgeichdlflllgky
    nilpydtsndsiyactnikhldfinpfgvaagfdkngvcidsilklgfsfieigtitprg
    qtgnakprifrdvesrsiinscgfnnmgcdkvtenlilfrkrqeedkllskhivgvsigk
    nkdtvnivddlkycinkigryadyiainvsspntpglrdnqeagklkniilsvkeeidnl
    eknnimndeflwfnttkkkplvfvklapdlnqeqkkeiadvlletnidgmiisntttqin
    diksfenkkggvsgaklkdistkficemynytnkqipiiasggifsgldalekieagasv
    cqlysclvfngmksavqikrelnhllyqrgyynlkeaigrkhsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i55A (A:)
    esynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfi
    npfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgf
    nnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryady
    iainvsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfv
    klapdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkf
    icemynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnh
    llyqrgyynlkeaigrkhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6i55B (B:)
    mhhhhhhssgvdlgtenlyfqsmfesynpefflydiflkfclkyidgeichdlflllgky
    nilpydtsndsiyactnikhldfinpfgvaagfdkngvcidsilklgfsfieigtitprg
    qtgnakprifrdvesrsiinscgfnnmgcdkvtenlilfrkrqeedkllskhivgvsigk
    nkdtvnivddlkycinkigryadyiainvsspntpglrdnqeagklkniilsvkeeidnl
    eknnimndeflwfnttkkkplvfvklapdlnqeqkkeiadvlletnidgmiisntttqin
    diksfenkkggvsgaklkdistkficemynytnkqipiiasggifsgldalekieagasv
    cqlysclvfngmksavqikrelnhllyqrgyynlkeaigrkhsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i55B (B:)
    fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
    inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
    fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
    yiainvsspntpglrdnqeagklkniilsvkeeidnlwfnttkkkplvfvklapdlnqeq
    kkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemynytnk
    qipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgyynl
    keaigrkh