PDB entry 6i52

View 6i52 on RCSB PDB site
Description: yeast rpa bound to ssdna
Deposited on 2018-11-12, released 2018-12-19
The last revision was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: EM
Resolution: 4.7 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Replication factor A protein 3
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: RFA3, YJL173C, J0506
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26755 (0-121)
• Chain 'B':
  Compound: Replication factor A protein 2
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: RFA2, BUF1, YNL312W, N0368
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26754 (0-131)
• Chain 'C':
  Compound: Replication factor A protein 1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: RFA1, BUF2, RPA1, YAR007C, FUN3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22336 (0-177)
• Chain 'D':
  Compound: DNA (5'-d(p*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*tp*t)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6i52A (A:)
  masetprvdpteisnvnapvfriiaqiksqptesqlilqsptisskngsevemitlnnir
  vsmnktfeidswyefvcrnnddgelgflildavlckfkenedlslngvvalqrlckkype
  iy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6i52B (B:)
  tntrvntltpvtikqileskqdiqdgpfvshnqelhhvcfvgvvrnitdhtanifltied
  gtgqievrkwsedaaqqfeiggyvkvfgalkefggkkniqyavikpidsfnevlthhlev
  ikchsiasgmmk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6i52C (C:)
  kfiaqritiaraqaenlgrsekgdffsvkaaisflkvdnfaypacsnencnkkvleqpdg
  twrcekcdtnnarpnwryiltisiidetnqlwltlfddqakqllgvdantlmslkeedpn
  eftkitqsiqmneydfriraredtyndqsrirytvanlhslnyraeadyladelskal
  

  
  
• Chain 'D':
  No sequence available.