PDB entry 6i4r

View 6i4r on RCSB PDB site
Description: crystal structure of the disease-causing r460g mutant of the human dihydrolipoamide dehydrogenase at 1.44 angstrom resolution
Deposited on 2018-11-10, released 2019-11-20
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrolipoyl dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DLD, GCSL, LAD, PHE3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09622 (Start-495)
      • engineered mutation (481)
  • Chain 'B':
    Compound: Dihydrolipoyl dehydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DLD, GCSL, LAD, PHE3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09622 (22-495)
      • expression tag (15-21)
      • engineered mutation (481)
  • Heterogens: FAD, SO4, BTB, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i4rA (A:)
    maswshpqfekgalevlfqgpgadqpidadvtvigsgpggyvaaikaaqlgfktvciekn
    etlggtclnvgcipskallnnshyyhmahgkdfasrgiemsevrlnldkmmeqkstavka
    ltggiahlfkqnkvvhvngygkitgknqvtatkadggtqvidtkniliatgsevtpfpgi
    tidedtivsstgalslkkvpekmvvigagvigvelgsvwqrlgadvtaveflghvggvgi
    dmeisknfqrilqkqgfkfklntkvtgatkksdgkidvsieaasggkaevitcdvllvci
    grrpftknlgleelgieldprgripvntrfqtkipniyaigdvvagpmlahkaedegiic
    vegmaggavhidyncvpsviythpevawvgkseeqlkeegieykvgkfpfaansraktna
    dtdgmvkilgqkstdrvlgahilgpgagemvneaalaleygascediarvchahptlsea
    fgeanlaasfgksinf
    

    Sequence, based on observed residues (ATOM records):
    >6i4rA (A:)
    qpidadvtvigsgpggyvaaikaaqlgfktvcieknetlggtclnvgcipskallnnshy
    yhmahgkdfasrgiemsevrlnldkmmeqkstavkaltggiahlfkqnkvvhvngygkit
    gknqvtatkadggtqvidtkniliatgsevtpfpgitidedtivsstgalslkkvpekmv
    vigagvigvelgsvwqrlgadvtaveflghvggvgidmeisknfqrilqkqgfkfklntk
    vtgatkksdgkidvsieaasggkaevitcdvllvcigrrpftknlgleelgieldprgri
    pvntrfqtkipniyaigdvvagpmlahkaedegiicvegmaggavhidyncvpsviythp
    evawvgkseeqlkeegieykvgkfpfaansraktnadtdgmvkilgqkstdrvlgahilg
    pgagemvneaalaleygascediarvchahptlseafgeanlaasfgksinf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i4rB (B:)
    maswshpqfekgalevlfqgpgadqpidadvtvigsgpggyvaaikaaqlgfktvciekn
    etlggtclnvgcipskallnnshyyhmahgkdfasrgiemsevrlnldkmmeqkstavka
    ltggiahlfkqnkvvhvngygkitgknqvtatkadggtqvidtkniliatgsevtpfpgi
    tidedtivsstgalslkkvpekmvvigagvigvelgsvwqrlgadvtaveflghvggvgi
    dmeisknfqrilqkqgfkfklntkvtgatkksdgkidvsieaasggkaevitcdvllvci
    grrpftknlgleelgieldprgripvntrfqtkipniyaigdvvagpmlahkaedegiic
    vegmaggavhidyncvpsviythpevawvgkseeqlkeegieykvgkfpfaansraktna
    dtdgmvkilgqkstdrvlgahilgpgagemvneaalaleygascediarvchahptlsea
    fgeanlaasfgksinf
    

    Sequence, based on observed residues (ATOM records):
    >6i4rB (B:)
    vlfqgpgadqpidadvtvigsgpggyvaaikaaqlgfktvcieknetlggtclnvgcips
    kallnnshyyhmahgkdfasrgiemsevrlnldkmmeqkstavkaltggiahlfkqnkvv
    hvngygkitgknqvtatkadggtqvidtkniliatgsevtpfpgitidedtivsstgals
    lkkvpekmvvigagvigvelgsvwqrlgadvtaveflghvggvgidmeisknfqrilqkq
    gfkfklntkvtgatkksdgkidvsieaasggkaevitcdvllvcigrrpftknlgleelg
    ieldprgripvntrfqtkipniyaigdvvagpmlahkaedegiicvegmaggavhidync
    vpsviythpevawvgkseeqlkeegieykvgkfpfaansraktnadtdgmvkilgqkstd
    rvlgahilgpgagemvneaalaleygascediarvchahptlseafgeanlaasfgksin
    f