PDB entry 6i45

View 6i45 on RCSB PDB site
Description: Crystal structure of I13V/I62V/V77I South African HIV-1 subtype C protease containing a D25A mutation
Class: hydrolase
Keywords: HIV, AIDS, Human, Protease, Hydrolase, apo
Deposited on 2018-11-09, released 2020-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50BW9 (0-98)
      • conflict (6)
      • conflict (12)
      • engineered mutation (24)
      • conflict (61)
    Domains in SCOPe 2.08: d6i45a_
  • Heterogens: NA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6i45A (A:)
pqitlwkrplvsvkvggqikeallatgaddtvleeinlpgkwkpkmiggiggfikvrqyd
qvlieicgkkaigtvligptpvniigrnmltqlgctlnf