PDB entry 6i42

View 6i42 on RCSB PDB site
Description: Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex
Class: isomerase
Keywords: cyclophilin A, peptidyl-prolyl isomerase, alpha-Synuclein, PreNAC, ISOMERASE
Deposited on 2018-11-08, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i42a_
  • Chain 'B':
    Compound: Alpha-synuclein
    Species: Homo sapiens [TaxId:9606]
    Gene: SNCA, NACP, PARK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6i42A (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.